PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK39876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 351aa    MW: 39114 Da    PI: 7.1682
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK39876.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.7e-33178236159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+vers +dp++v +tYeg+H h+
  KFK39876.1 178 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSYDDPSIVMTTYEGQHSHP 236
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.3E-34163238IPR003657WRKY domain
SuperFamilySSF1182901.09E-29171238IPR003657WRKY domain
PROSITE profilePS5081132.432173238IPR003657WRKY domain
SMARTSM007744.8E-39178237IPR003657WRKY domain
PfamPF031062.8E-26179236IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MANLVTSSDH HHSQLELAGN NNMNLSSIFD TSITLPFPYS YFEYHSSTNP NSFIDLLRQD  60
PQFPSSSNPS SFSFDAFPLP NNNNPFFTDL PLPHPATTTK AESSEVVNTT PTSPNSTSVS  120
SSSNEAANDT TNKEASVKIQ EEHEQKGTKP ELKAKKKNQK KAREPRFAFL TKSDIDNLDD  180
GYRWRKYGQK AVKNSPYPRS YYRCTTVGCG VKKRVERSYD DPSIVMTTYE GQHSHPFPMT  240
PRGHMGMLTS PILDHGATST SSSSFSIPQP RYLMSQDHQP YNNSLSMINR SSSDGNFVNP  300
GFPGFAYDMS QASTSTSSSI RDHGLLQDIL PSQIRPDTIN NAQTKEQDDK K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-271712381077Probable WRKY transcription factor 4
1wj2_A2e-271712381077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300590.0KF430059.1 Brassica rapa WRKY transcription factor 48 (WRKY48) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013644071.11e-174PREDICTED: probable WRKY transcription factor 48
SwissprotQ9FGZ41e-157WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLA0A087HCM40.0A0A087HCM4_ARAAL; Uncharacterized protein
STRINGBra010032.1-P1e-174(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56242648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-136WRKY DNA-binding protein 48